Question

What is the main purpose of the AgriSURE Fund, with an

Q: What is the main purpose of the AgriSURE Fund, with an outlay of ₹750 crore, launched by the Union

TheAgriSUREFundisablendedcapitalfunddesignedtosupporttechnologydrivenhighriskhighimpactventuresintheagriculturalandruralstartupecosystemwithanoutlayof750crore

outlay of ₹750 crore, launched by the Union Agriculture Minister?

A To promote rural tourism

B To encourage technology-driven agricultural start-ups

C To provide direct subsidies to small farmers

D To enhance irrigation and water management systems

E To promote organic farming among small farmers

Practice Next

More Static GA Questions

Which of the following is NOT a part of the 'Five Fs' in maintaining sanitary hygiene?
The Weight of an object on Earth is 600 N. What will be its weight on moon?
The sky appears blue because of –
What is the name of the protein digesting enzyme released by the gastric glands?
The PH of an aqueous solution of a salt is 4.5. Which of the following about this salt is true?
Which of the following is the correct set-up for electrolytic refining of silver?
Which of the following is not an equation of motion?
Which of the two temperature scales are same ?
Which of the following statement(s) is/are true?

I. During inhalation ribs move out

II. During exhalation ribs move in
Motion that repeats itself after some period of time, is called ______ motion.

Relevant for Exams:

ECGC PO

Question

What is the main purpose of the AgriSURE Fund, with an

Solution

Relevant for Exams:

Download the app